SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000150868 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000150868
Domain Number 1 Region: 2-86
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000777
Family FAD-linked reductases, N-terminal domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000150868
Sequence length 224
Sequence
MRHPLTGGGMTVALSDIVLLRDLLRPLSDFNDAPALCDYLESFYTLRKPVSSTINTLAGA
LYKVFCASPDPARQEMREACFDYLSLGGICSNGPISLLSGICSNGPISPRQINLFLHFFA
VAVYGVGRLMIPFPTPKRMWLGARLILSASGIIFPIIKAEGVRQMFFPATMPAYYRVPPH
SSFYNREQDYTRTLYLTLLFVYSLQTSDYSFSTFAMLASAICGF
Download sequence
Identical sequences MDP0000150868 MDP0000150868|PACid:22621264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]