SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000152184 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000152184
Domain Number 1 Region: 7-210
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.17e-34
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0046
Further Details:      
 
Domain Number 2 Region: 167-331
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.15e-27
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0011
Further Details:      
 
Domain Number 3 Region: 336-420
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00000000000261
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000152184
Sequence length 479
Sequence
MGRAFVYVILGGGVAAGYAALEFTKRGISHGELCIISEESVPPYERPALSKGFLLPEAPA
RLPSFHTCVGANEERLTPEWYKEHGIELVIGTQVKSVDVRRKTLLXGSGETISYKVLIIA
TGARALKLEEFGVKGSDSGNVCYLRDLADANRLVDLMESSSGGNAXVIGGGYIGMECAAS
LVINRMNVTMVFPEEHCMARLFTPKIASFYEEFYKSKGVKFVXGTILSXFDIASNRKVTA
VNLRDGSSLPADVVVVGIGIRPNKSLFEGQLTLEKGGIKVNGKMQSSNSSVYAVGDVATF
PVKVFGESRRLEHVDSARKSARHAVTAIMERNQVDEFDYLPFFYSRIFTLSWQFYGDNAG
DVVHFGDFSGGTFGAYWVRKGQLVGSFLEGGTKEEYEAIAKATRQKPEVEDLAELERQGL
GFALTVSQKPQPSSPPHDVTSSGIVQERPMYXFHATVGVVVAASIAAFAYRYGRKRRRW
Download sequence
Identical sequences XP_008379236.1.92800 MDP0000152184|PACid:22632666 MDP0000152184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]