SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000154720 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000154720
Domain Number 1 Region: 56-256,378-494
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.38e-49
Family FAD-linked reductases, N-terminal domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000154720
Sequence length 509
Sequence
MNSLIIRRNLAESIKRLKLSQRALCTDAAAKVSSSNGAQPGNGRVAQPIFSNKSNPYDIA
IVGGGMVGMALACSLAKMPLTKHLKVAIIDSNPAVSNGLSIKKEDPPDPRVSTVTPVTIS
LFKDIGAWKYVEQNRHAYFDQMQVWDYTGLGYTRYDARDVHKDSLGCVVENKVLHSSLLS
CMQNTDFQKTIYPSRLSTMTLQPRNLSMGVGSTSSGLNEQGNLAKLDLIDGNSLYAKLVV
GADGSKSRVRELAGFKTTGWSYSQNAIICTVEHSVENRCAWQRFLPAGPIALLPIGDNFS
NIVWTMKPKEATDRKLKAEDEFVKDVNYALDYGFGPHPGSSTSGGGGIFSLFTNANLSAN
DCFKVPPKVLKLVSERMVFPLSLMHANNYASKHVVLIGDAAHTVHPLAGQGVNLGFGDAF
ALSRIISEGIAVGRDIAEVSLLKKYEAERKSANVTMMAILDGFQKAYSVDFGPLNVIRAA
AFNGAQYFPPLKRSIISYASGDQRLPIFS
Download sequence
Identical sequences MDP0000154720 XP_008389891.1.92800 XP_008390506.1.92800 MDP0000154720|PACid:22639222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]