SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000155608 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000155608
Domain Number 1 Region: 7-179,302-406
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.24e-32
Family FAD-linked reductases, N-terminal domain 0.026
Further Details:      
 
Domain Number 2 Region: 128-231
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000872
Family FAD-linked reductases, N-terminal domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000155608
Sequence length 425
Sequence
MPLTKHLKVAIIDSNPAVSNGLSIKKEDPPDPRASAVAPATISLFQDIGAWKYVEQNRHA
YFDQMQVWDYTGLGYTRYNARDVHKDSLGCVVENKVLHSSLLSCMQNTDFQKTVYPSRLS
TMTLQPRNLSMGMESTSSGLNEQGNLAKLDLIDGNSLYAKLVVGADGSKSRVRELAGFKT
TGWNYSQNAIICTVEHSVENRFAWQRFLPAGPIALLPIGDNFSNIVWTMNPNEATDRKLK
AEDEFLKDVNYALDYGFGPHPKSSTSGGGSIFSWFKTDTNLSANDCFKVPPKVLKLASER
TVFPLSLMHANDYVSKHVVLIGDAAHTVHPLAGKGLIWGLETHLLYQESFVLLLKKYEAE
RKSANVTMMAILDGFQKAYSVDFGPLNVLRPAAFNGAQYIPPLKRSIISYALRGSKIANF
FLRRT
Download sequence
Identical sequences MDP0000155608|PACid:22665289 MDP0000155608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]