SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000158474 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000158474
Domain Number 1 Region: 39-331,537-593
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.76e-49
Family FAD-linked reductases, N-terminal domain 0.0000119
Further Details:      
 
Domain Number 2 Region: 339-541
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 6.77e-33
Family GMC oxidoreductases 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000158474
Sequence length 605
Sequence
MPVSVTAGKGNFYEFRYPFIKRASSFPSVSSSSSSGHNNGYDYIVVGGGTAGCPLAATLS
KNFNVLVLERGGVPFSNANVSFLQNFHIALADTSPTSASQPFVSTDGVINTRARVLGGGS
CINAGFYTRASTRLNASCVPHVLKLSSHFYGGRLGSEIVRPNKFIKRVGWDAKIVNESYP
WIEKQIVHQPKLEPWQVAIRDSLLSVGVSPFNGFTYDHVYGTKVGGTIYDRFGRRHTSAE
LLSSGNPQKLTVLVYATVQKIVFDISGKKPRAVGVIFKDEKGNQHQALLADKPQSEVILS
TGAIGSPQMLLLSGIGPKADLQKLKIPVVLDNKFVGKGMADNPMNAVFVPSSKPEKQTLI
ETVGITKMGVYIEGSSGFSQSKDSIQCHHGIMSAEIGQLSTIPPKQRTPEAIQAYIRSKK
NLPHEAFRGGFILEKIASPLSKGDLSLVNTNVDDNPSVTFNYFSHPYDLQRCVDGIRMAT
KVVQSEHFTNYTKCDRQTAEKVLDMSVKANVNLIPKHTNDTKSLEQFCKDTVITIWHYHG
GCHVGTVVSPEHKVLGVDRVRVVDGSTFSESPGTNPQATVMMMGRYFGVKIVRERLGTAA
GSFDV
Download sequence
Identical sequences MDP0000158474 MDP0000158474|PACid:22655457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]