SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000158720 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000158720
Domain Number 1 Region: 61-247,334-408
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.45e-27
Family HI0933 N-terminal domain-like 0.00069
Further Details:      
 
Domain Number 2 Region: 270-308
Classification Level Classification E-value
Superfamily HI0933 insert domain-like 0.0000628
Family HI0933 insert domain-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000158720
Sequence length 422
Sequence
MSFTLARFTLARSAVRHSRVRSEAAAPAKNNGLLISTPKQKKFTSTAIPTAQNKASEELL
VVVGGGAAGVYGAIRAKTLAPNLNVVIIEKGRPLSKVKISGGGRCNVTNGHCVDTMVLAE
NYPRGHRELKGAFFNTHGPADTMSWFXDQGVELKTEDDGRVFPVSNSSSTIIDCLMSEST
RLGVSLQTGKAVVTASSTDGGKFLLGVENRTFSSPEYVEADYLLIASGNSKQGYSLASQL
GHSIVDPVPSLFTFKIEDXQLRDLSGDLHGDTLWASISKNSLISLAHMLKNCNFYVTGKS
QYKDEFVTAGGVPLSEVSPSLSPSPFLPFFFTFIGSVILCLAFVKISLNTMESKIQSRLF
FAGETHGVLLIVLKSNVCFQVLNVDGITGGFNFQNAWSGGYIAGTSIDGPDEEAVGDVGR
PN
Download sequence
Identical sequences MDP0000158720|PACid:22655873 MDP0000158720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]