SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000159189 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000159189
Domain Number 1 Region: 59-224,326-450
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.94e-51
Family FAD-linked reductases, N-terminal domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000159189
Sequence length 467
Sequence
MFAKVEFQTPSISLLXXGIVKSHLPXILYCNPTYXITIQQSNSETASIISSLMEVVEESV
VIVGAGIAGLSAALGLHRLGIRSLVLESSDSXRXTGFXLTTWTNAWKALDALGTGDTLRQ
QHGALRGNVTSSTISGLPVFEMSFKAKGKNGDHEVRRVKRRLLLEALADELPSGTIRFSS
KVVSIDESGYLKLVHXADGTILKAKVLVGCDGVNSVVAKWLGFKQPAFTGRSAIRGLANF
KSSHGFDPIFMKFFGNGIRYGVIPCDDKTVHWYYTWAPTSQEKELEENPGQLKQYMLSKL
GKIPDKVKAVVENTELDXFVSXPLRYRHPWXILWGNISKGNVCVAGDALHPMTPDIGQGG
CAALEDGVVLARCLGXALLKSSRHETKDKAGEEGKEEYERIETGLKKYATERRWRSFDLI
STALVVGFFQESDGKIMNFLRDKYLAPILAGLLLKKSDFDCGKLSIS
Download sequence
Identical sequences MDP0000159189|PACid:22672554 MDP0000159189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]