SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000159873 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000159873
Domain Number 1 Region: 54-232,313-438
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.4e-36
Family FAD/NAD-linked reductases, N-terminal and central domains 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000159873
Sequence length 466
Sequence
MASIALKSFIGLRQTAAEKPHFTIQAKPISPNPSNHRTLQVKAAKTSPKVTGRNLRVAVI
GGGPAGGAAAETLAKGGVETFLIERKMDNCKPCGGAIPLCMVGEFNLPLDIIDRRVTKMK
MISPSNVAVDIGQTLKPHEYIGMVRREVLDQYLRNRASENGATVINGLFLKMDKPGDGEA
PYVLHYTEYDGKAGGIGVKKTMEVDAVIGADGANSRVAKNIDAGDYEYAIAFQERIKIPD
DKMVYYENLAEMYVGDDVSPDFYGWVFPKCDHVAVGTGTVTHKGDIKKFQLATRNRAKDK
ILGGKILRVEAHPIPEHPRPRRLAGRVALVGDAAGYVTKCSGEGIYFAAKSGRMCAEAIV
EGSENGKRMVNEADLRTYLEKWDKTYWPTYKVLDVLQKVFYRSNPAREAFVEMCADEYVQ
KMTFDSYLYKRVVPGNPWEDLKLAVNTIGSLVRANALRREMEKINV
Download sequence
Identical sequences XP_008374552.1.92800 MDP0000159873 MDP0000159873|PACid:22673571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]