SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000167343 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000167343
Domain Number 1 Region: 9-252
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.27e-33
Family FAD/NAD-linked reductases, N-terminal and central domains 0.054
Further Details:      
 
Domain Number 2 Region: 317-496
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000168
Family FAD/NAD-linked reductases, N-terminal and central domains 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000167343
Sequence length 500
Sequence
MAPIVSKLGIIGAGVSGIAAAKQLAHYNPIILEASDSIGGVWRHCSYNSTKLQSHRCDYE
FSDFPWPDRDNTDYPSYLEILDYLKSYAEHFDVLKFVRFNSKVVEVRFVGDRETTDFDVK
PVEYQSLSXAGGQPVWEVAVQTNDSETIQWYAFEFIVVCIGKYGDXPQIPEFPLNKGPEV
FQGQALHTLDYCKLDKDAASELLKDKEVVVVGYKKSAIDLAVECAEANQGPEGKPCTMVV
RTLHWIVPHYWIWGLPFFLFYSTRSSQFLHQRPNQSFLRTLLCSLIMSPMGLKPDHPFEE
DYASCQMAIMPENFFSEADKGKIVFKRSTSKWWFSADGIEFDDNTKIKADVVVLATGYDG
KKKLKSILXXPFRSLLECPSGIIPLYRGTIHPLIPNMAFVGYLESVSNLHSSELRSIWLA
RLLDXKFKLPSVQKMLEQTSKEVEISKKTTRFYRRHCISTFSINHSDEICEEMGWTSWRK
NTWLAEAFSPYGSQDYLNKH
Download sequence
Identical sequences MDP0000167343|PACid:22638473 MDP0000167343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]