SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000168437 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000168437
Domain Number 1 Region: 55-227,321-431
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.59e-44
Family FAD/NAD-linked reductases, N-terminal and central domains 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000168437
Sequence length 487
Sequence
MVYLNIVCAVIASLLGFVFLCSLRRQKKARAHQNGNCLKSCENGTCDEAKMVESADIIVV
GAGVVGSALAYTLGKDGRRVHVXERDLSEPDRIVGELLQPGGYLRLVELGLEDCVNEIDA
QRVFGYALYKDGKSTKLPYPLENFHPDVAGRSFHHGRFIQRMREKASSLPNVRLEQGTVT
SLLEEKGTVKGVQYKSKGXDLELSAHAPLTIVCDGCYSNLRHSLCNPKVDIPSCFVGLVL
ENCQLPYANHGHVILADPSPILFYPISSTEIRCLVDVPGQKVPSISGGEMSRYLKTKVAP
QVPPELYAAFMAAADKGNIKSMPNRSMPAAPRPTPGVLLMGDAVNMRHPLTGGGMTVALS
DIVVLRNLLRPLHNLNDAPALCKYLESFYTLRKPVASTINTLAGALYRVFCASPDPARME
MRQACFDYLSLGGVFSNGPLALLSGLNPQPLSLGASGIIFPIINSEGVRQMFFPVTVASY
YRTPPIN
Download sequence
Identical sequences MDP0000168437 MDP0000168437|PACid:22624648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]