SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000168919 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000168919
Domain Number 1 Region: 29-82,181-291
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.09e-19
Family FAD-linked reductases, N-terminal domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000168919
Sequence length 373
Sequence
MGVSFKECXIKLHLFQXILLFLSNIPXVXLEQGTVTSLLEEKGTIKGVKFRRKGSQXFTA
HAPLTIVCDGCCSNLRRYLCNPKVDIPSCFVGLILEDCQLPYANHAHVILGDPSLVSFYP
IGNMEIRCLVDVPGRQVPSISSGEWLTTWKQRWHPSRIIFQVPPELYTAFLVAIDKGNRK
AMPTRSMPATAYHTPGALLMGDAVNMRHPITGGGMVVALSDVVALRNLLRPLRNLNDVPA
LFKYLESFYTLRKQPAAFTXNTLAGAAXKVLSASPDPARKELRQACFDYFXLGRVFSNGA
LAAFSGLNYCPWSVVLHFFVVGIYAVGRLLIPFPSPKRIWIAARLILRWRRGYTKGAMAQ
RGPKIFYPPIYYI
Download sequence
Identical sequences MDP0000168919 MDP0000168919|PACid:22641114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]