SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000169201 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000169201
Domain Number 1 Region: 1-248
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.32e-40
Family FAD/NAD-linked reductases, N-terminal and central domains 0.013
Further Details:      
 
Domain Number 2 Region: 357-515
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000216
Family FAD/NAD-linked reductases, N-terminal and central domains 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000169201
Sequence length 518
Sequence
MGKQVAIVGAGISGLLACKYTLSKGFQPIVFESTSSIGGVWTKTIESTKLQTPKPLYQFS
DFPWPSSVEEDFPSQHQVLDYIQSYAQHFDLLKHIKFDTKVCGIEYEGASEDEMQAWSHW
GGTGEPFSSXGKWKVAVEDKHSRSTEVYLVDFVILCIGRFSDVPNIPEFPFNKGPEAFHG
EVIHSKDYAAMDYERARNFVKGKRVTVVGFQKSALDIAMECSNANGIEHPCTVIYKTEHW
TLPDYLPWGVPLTYLYXNRFSELLIHKPGEGILLGLLATILSPLRWGFSKFVESYVTKKL
GLAKYGMVPRHSFLQEISSCLISTIPEKFYDRVQEGSIILKKSPGSFSFCQEGVLVEGEV
SPVKTDVMILATGFRGDKKLKDIFVSPTFQDYIAGSPEAILPLYRECIHGRIPQLAVIGF
SESLSNLXTSEMRCRWVAELLGGTFTLPSIKEMEKDVNEWDGFAKRYAGKYYRRSCNGTV
HIWYNDQLCKDMGWNPKRKKGLFAELFEPYGPLDYAPS
Download sequence
Identical sequences MDP0000169201 MDP0000169201|PACid:22625917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]