SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000169409 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000169409
Domain Number 1 Region: 27-132
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000183
Family FAD-linked reductases, N-terminal domain 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000169409
Sequence length 137
Sequence
MASSVLCSLFPQKEELTSGSKPSQVRSFLVLERGGSPYGNPNIINIENFAPTLLDTSPTS
PGQHFTSEDRVFNICTRVLGGGSVLNARFYKRASTHYIREVGWNQGMVDQSYEWVEKVVA
FEPEILQWESAFRDGLY
Download sequence
Identical sequences MDP0000169409|PACid:22673915 MDP0000169409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]