SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000170521 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000170521
Domain Number 1 Region: 2-135
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000932
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000170521
Sequence length 162
Sequence
MDDNRVGPLYKHIFPPSLAPALSFVGLPWKAEPFPMFELQSKWIAGVLSNRIALPSQQEM
MEDVKAFYSSLEASGTPKHYTHDISPYKFGYEDWLAAQCGCPVFEEWRKQMFVAAIQNLI
KRQETYRNEWDDHHLVLQAHEDFRKXTLKGIGVMDKRYRMLS
Download sequence
Identical sequences MDP0000170521 MDP0000170521|PACid:22675770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]