SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000172898 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000172898
Domain Number 1 Region: 112-189
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 0.0000000000345
Family UDPGT-like 0.0014
Further Details:      
 
Weak hits

Sequence:  MDP0000172898
Domain Number - Region: 12-107
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00141
Family Extended AAA-ATPase domain 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000172898
Sequence length 207
Sequence
MTKTQKWFFGQVVIGPPGLGKTAYCNGMSEYIQLIQRKVFMCCIAFQHRILRSRFGDFEM
LDVGPVTPQQVNLKTFIVIHRTLTECAISIHIDDDEELGDEEEMMKADDQKPCFSDRKVH
ARYVNQVWRVGFQLEDKLEKGEIERAIKKLMADDDGKEMSVRAMELKEKVDVCTRKGSSS
YNFSNELVELHHFILIASLRLEINLPC
Download sequence
Identical sequences MDP0000172898|PACid:22679666 MDP0000172898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]