SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000175650 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000175650
Domain Number 1 Region: 47-248,345-437
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.41e-44
Family FAD-linked reductases, N-terminal domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000175650
Sequence length 718
Sequence
MAVSRLFRSFSGLHKANARIQAYPFGYKHSRALSSDSFNNGDDTVLPVLIVGAGPVGLVL
SILLTKLGVKCSVVEKSKTFSNHPQAHFINNRSMEVFRKLDGLAEEIQRSQPPVDLWRKF
IYCTSLYGSILGSVDHMQPQDFEQVVSPVSVAHFSQYKLISLLLKQLENLSFKFCTSDGL
EGLNHGTFQEKQLLMGHECVSIKASDDFVSVTASFLKDGKRMERNIRCNILVGTDGAGST
VRKLAGVDMRGEKDLQKLVSVHFLSKGLGKYLLCERPGMLFFIFNTEAIGVLVAHDLEQG
EFVLQIPFYPPQQNLEDFSRQICEQIIFKLVGRELGDINVIDIKPWVMHAEVAEKFLSCG
NRIILAGDAAHRFPPAGGFGMNTGIQDSHNLAWKIASVVEGTAPTSILNSYETERRPIAV
FNTELSIENFKAAMAVPAALGLDPTVANSXHRVINEGVGSILPSELQRAILDGIFTIGRA
QLSESFLNENNPLGSSRLAKLRRIFEEGKSLQLQFPAEDLGFRYLEGALIPDSDGGMSAP
EGPTGRRRDYVPSVVPGARLPHMNVRILSDTSSEVTISTLDLISGDKVEFLLIISPTEPS
YHLAHAAFKVAEEFKVSARVCVLWPAGSVKGVEIKSKASLAPWENYIDLVEVKKSPNSSS
WWDICQMNDKGAILVRPDEHVAWRVKSGVVRDPITEMRRVFSATLGIKQHTKDQETDT
Download sequence
Identical sequences XP_008389816.1.92800 MDP0000175650|PACid:22652650 MDP0000175650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]