SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000177641 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000177641
Domain Number 1 Region: 80-362,512-566
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.49e-48
Family FAD-linked reductases, N-terminal domain 0.000031
Further Details:      
 
Domain Number 2 Region: 411-513
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 3.92e-20
Family GMC oxidoreductases 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000177641
Sequence length 570
Sequence
MTLPTNHVKLRFSCTTSCYQWTLINQTNQPTTKQIPKHRAKANEHEELELGIKYRTNNRV
NCRLCVGQTLPRKTTSDVNQVSGKSFDYIIVGGGTAGCPLAATLSEKFSVLLVERGGSPY
EXPLIMENKNYGLSLVQTDEYTSVAQSFVSKDGVSNLRGRVLGGGSAINGGFFSRASXDY
VKRVGWNKXMVSDAYKWVESRNAFKPKLTPWQYVAELSFLEAGIFPYNGFSLDHIXGTKI
GATTFDEQGRRHTSADLLTAGNPNXITLLLNATVTSIIFHEKGSRYETIVRGIRFIKSDG
SSSQTHEAYLNTQNNSRSSTGDVILAAGALGSPQILLLSGIGPQKHLNKFNIPVAVNLKS
VGKGMTDNPCIALLAEIADAKPKNFPPDSPKVTVIADDFKLVIQALILPXSFNATIMPIV
GKLAFPESEGELELNSTDPRKNPSVTFNYLAKEKDMAECVKLGRLLEKIVRSKSIAYFLG
IEGKRRNXSMSTDDELRKLCKNNVRTFYHYHGGCTMGSVVDKNYRVFGIXGLRVIDGSTF
LESPGTNPMATLLMLGRYQGIKILQERENA
Download sequence
Identical sequences MDP0000177641|PACid:22624304 MDP0000177641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]