SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000178034 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000178034
Domain Number 1 Region: 8-67
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 3.27e-17
Family Sm motif of small nuclear ribonucleoproteins, SNRNP 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000178034
Sequence length 191
Sequence
MATIPVNPKPFLNNLTGKTVIVKLKWGMEYKGFLVSTDAYMNLQLANTEEYIDGQSTGNL
GEILIRECDGHSDQSLTEWRQLMPDPVHSKTFVGNYSVDGGVISYHLVEQCHCFYHLGLA
MRPTFSIQSNYEASHGFGNQCLYIPKVNATYQVLLTLMVLQDLVGAPPLTLVSYHIALWS
SATAFTIWDWP
Download sequence
Identical sequences MDP0000178034 MDP0000178034|PACid:22656491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]