SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000182973 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000182973
Domain Number 1 Region: 35-276,387-432
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.04e-36
Family FAD-linked reductases, N-terminal domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000182973
Sequence length 435
Sequence
MLKSTLDRIVRSHRNVTSSCSISISSISGVPKEKVDCVVIGAGVVGLAVARELALKGREV
LVLDSAPTFGTSTSSRNSEVIHAGIYYPTHSLKAKFCVRGRYLLYKYCSEHNIPHKQIGK
LIVATGSSEIPNLHNLMHRGIQNGVDGLVMMEGSEAMRMEPELACLKALLSPLSGIVDTH
SLMLSLVYLSPLIPIWVQGEAENHGTTFSYNTTVIGGHIQQNHXCLHVSGTKTLENWNRK
FPLQPEMILIPKLVVNSAGLSAPALAKRFDGLRTEHIPPSRLARGCYFTLSNTTICPFRH
LIYPLPEDGGLGVHVTLDLNGQVKFGPDVEWIDGVDDVSSFLNKFDYSVCTNRKELFYPE
IRKYYPNLKDGSLEPGYAGIRPKLSGPRQSPVDFQIQGEDVHGITGLVNLFGIESPGLTS
SMGIAEHVATRFFRG
Download sequence
Identical sequences MDP0000182973|PACid:22649063 XP_008392508.1.92800 XP_008392509.1.92800 MDP0000182973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]