SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000185031 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000185031
Domain Number 1 Region: 7-60
Classification Level Classification E-value
Superfamily PP2C-like 0.0000000667
Family PP2C-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000185031
Sequence length 88
Sequence
MHALSRDCMSSQQLVDYVREQLKHESKLSVVCERVFERCLAPSSGGEGCDNMTMILVQFK
KPVASAASVGNQPIASNPPSEKEKTAAN
Download sequence
Identical sequences MDP0000185031 XP_008353755.1.92800 MDP0000185031|PACid:22652512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]