SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000187851 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000187851
Domain Number 1 Region: 217-261
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000149
Family EGF-type module 0.003
Further Details:      
 
Weak hits

Sequence:  MDP0000187851
Domain Number - Region: 184-212
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00015
Family EGF-type module 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000187851
Sequence length 300
Sequence
MTGNLEITNISLYDGELQILQYVASDCYDAQGXTXEWYSPWFTVXPPYTISHTKNTFVAL
GCDTYSFFIGYRGEEKYTTXCTSICNNLGNAIDQXDTCSGVGCCQTKIPSGLQNXTXELY
SYYNHSDVWEFNPCSYAFLVQEGEFNFNSTSFRELNYTTQXPAIIDWEIGNESCDIAAKN
XGTFGCKANSSCHNRSSGYICRCLPGYEGNPYLPDGCQDIDECXAPNPCSMGTCINTPGN
YTCXCPXGYKNDDPDKIRCIKXXGRAKLXLLLIISLGXCFCIYNGXWVKGKVELGSCVRT
Download sequence
Identical sequences MDP0000187851|PACid:22657019 MDP0000187851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]