SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000188994 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000188994
Domain Number 1 Region: 7-172,274-397
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.3e-51
Family FAD-linked reductases, N-terminal domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000188994
Sequence length 415
Sequence
MEVVEESVVIVGAGIAGLSAALGLHRLGIRSLVLESSDSXRXTGFXLTTWTNAWKALDAL
GTGDTLRQQHGALRGNVTSSTISGLPVFEMSFKAKGKNGDHEVRRVKRRLLLEALADELP
SGTIRFSSKVVSIDESGYLKLVHXADGTILKAKVLVGCDGVNSVVAKWLGFKQPAFTGRS
AIRGLANFKSSHGFDPIFMKFFGNGIRYGVIPCDDKTVHWYYTWAPTSQEKELEENPGQL
KQYMLSKLGKIPDKVKAVVENTELDXFVSXPLRYRHPWXILWGNISKGNVCVAGDALHPM
TPDIGQGGCAALEDGVVLARCLGEALLKSSRHETKDKAGEEGKEEYERIETGLKKYATER
RWRSFDLISTALVVGFFQESDGKIMNFLRDKYLXPILAGLLLKKSDFDCGKLSIS
Download sequence
Identical sequences MDP0000188994 XP_008347512.1.92800 MDP0000188994|PACid:22643055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]