SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000189790 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000189790
Domain Number 1 Region: 58-242,336-410
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.02e-38
Family FAD-linked reductases, N-terminal domain 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000189790
Sequence length 529
Sequence
MVFQLMLVAVVAFLLGFVSSYGFRRKKKDRALVKDRNVNGWRSSENGMCLQKDIGAGVDV
IIVGAGVAGSALAYTLGKIVISYNIICIELQDGXRVHVIERDLTKPDRIVGELLQPGAYL
RLIELGLEDCVNKXDAQXIFGYVLYKDGIRTKLPYPSENFNPDVVGVSFHHGRFIQRMRD
KASSLPSVELEQGTVTSLLEEKGTIKGVKFRRKGSQEFTAHAPLTIVCDGCCSNLRRYLC
NPKVDIPSCFVGLILEDCQLPYANHAHVILGDPSLVSFYPIGSREIRCLVDVPGQQVPSI
SSGEMAHYLKTKVAPQVXPELYTAFLVAIDKGNIKTMPTRSMPATASHTPGALLMGDAVN
MRHPITGGGMVVALSDVVVLRNLLRPLRNLNDVPALFKYLESFYTLRKVSSLCLSLLAVG
SNLQPAAFTINTLAGAAYKVLCASPDPARKELRQACFDYFCLGRVFSNGALAAFSGLNYC
PWSLVIQFFVVGIYAVGRLLIPFPSPKRIWIAARLILVSNSITTTTPTK
Download sequence
Identical sequences MDP0000189790|PACid:22676146 MDP0000189790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]