SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000193196 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000193196
Domain Number 1 Region: 53-225,319-429
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.14e-42
Family FAD-linked reductases, N-terminal domain 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000193196
Sequence length 676
Sequence
MVYEYVLAGVLVSLLSSVFFVIINTTFSEKKKDDVANVSATGVFLAPEIEKSTDVVIVGA
GVAGAALAYTLGKEGXRVHVIERDLNEPDRIVGELLQPGGYLKLIELGLEDCANESIDAQ
KVFGYALYKNGNDTKLSYPLETYSSDIAGRSFHNGRFIQRMRGRASTLSNVKLEQGTVTX
LIEEKGTIKGVMYKNKAGEEMRTYAPLTIVCDGCFSNLRRSISTPNIENPSCFVGMILEN
CELPHANHGHVXLGDPSPILFYPISSTEVRCLVDVPGTKVPSVANGEMAQYLKTAVAPQV
PHQLLKAFLAAVDKGIIRTMQNKSMPAAPQPTPGAILLGDAFNMRHPLTGGGMTVALSDI
VLLRDLLRPLSDFNDAPALCDYLESFYTLRKPVSSTINTLAGALYKVFCASPNPARQEMR
EACFDYLSLGGICSNGPISLLSGLNPRPISLFLHFFAVAVYGVGRLMIPFPTPKRMWLGA
RLILSASGIIFPIIKAEGVRKMFFPATMPAYYRVPPVHRRIKTSTKHFLISLLQIFNKTL
NISPHQHQFKLNLPTAIYNRRVWNLVSFVDGTNKCPSAFLKDDEGALIDEVNPEFDAWIQ
QDAMVLSWINSSVHPTVLASLIGPYRGRGASWGGRGPFNGGRGQFSPGPPAKANMLLTLD
LLMMVFSAPIHLRLKM
Download sequence
Identical sequences MDP0000193196|PACid:22649572 MDP0000193196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]