SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000194622 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000194622
Domain Number 1 Region: 264-424,519-646
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.59e-32
Family HI0933 N-terminal domain-like 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000194622
Sequence length 680
Sequence
MALDTKELQKLQVGEVLVGDKNSRASMPRSDTRTTTEKSSPAAELPISDFDCFSLTFSXF
XLFFSQFLSVSFCVSXMNCLAWRIEEETNEDHRTRVPTWTKNSGRPPQTHMSLSSLRLRT
GHTHISFTFTISLGNFLISLGSSKIFSNCKDCSCFNTALLVALPVSRDIRDKCWNFMDTL
LKTHNKLAFLHPIHGFSEKLSSSSSSKLRNEEFGYGLRRSRVKLSRGGVVKASSSALLEL
VPEIKKESLEFELPLYDPSKGLVVDLAVVGGGPAGLAVAQQVSEAGLSVCSIDPSPKLIW
PNNYGVWVDEFEAMDMLDCLDTTWSGAVVYIDEESKKDLNRPYGRVNRKQLKSKMLQKCI
SNGVKFHQAKVTKVIHEEEKSLLTCNDGVTIQASVVLDATGFSRCLVQYDKPYNPGYQVA
YGILAEVEEHPFDVDKMLFMDWRDSHLNNNIELKERNGRIPTFLYAMPFSSNRIFLEETS
LVARPGLPMKDIQERMAARLKHLGIKVKSIEEDEHCVIPMGGPLPVLPQRVVGIGGTAGM
VHPSTGYMVARTLAAAPIVANAIVRYLGSDRTLSGNEVSAEIWKDLWPIQRRRQREFFCF
GMAILLKLDLKGTRRFFNAFFDLEPRYWHGFLSSRLFLPDLVFFGLSLFSHASNASRIEI
MAKGTPPLVKMINNLIQDRD
Download sequence
Identical sequences MDP0000194622 MDP0000194622|PACid:22683388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]