SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000196888 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000196888
Domain Number 1 Region: 121-155
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000117
Family Thi4-like 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000196888
Sequence length 164
Sequence
MDRVKESTNLFDQEEEDQRLASRPELYTEKKCRRVTDFHQRCHRPTRRCNASLTWVVLED
PHSHFSELPMVPGPPWSLNGSAPAYECVLAGVLVSLLSSXFFVIINTTFGEKKKVDVANV
SATGVFLTPEIEXSTDVVIVGAGVAGAALAYTLGKVIIISLSLS
Download sequence
Identical sequences MDP0000196888 MDP0000196888|PACid:22670849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]