SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000200780 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000200780
Domain Number 1 Region: 61-193,294-397
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.96e-47
Family FAD-linked reductases, N-terminal domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000200780
Sequence length 423
Sequence
MATLSSSLVFHNPLVSPYHSKIGSLSGTQSNWFQSPIRTRTRTKPNSCSIIKAQSGARSE
NIVIVGAGIAGLATALSLHRLGVGSLVLEQAESLRTGGTSLTLFKNGWRVXDAIGVGNHL
RTQFLEIQGMVVKTDNGRELRSFKFKEEDESQEVRAVERRILLETLAKELPPGAIVIGCD
GIRSPIATWMGFPEPKYVGHCAFRGLASYPDGQPFEPKLNQIYGKGQRAGFLPISPTKVY
WFVCYNRASLGPKITDGPFLKKQVTELVXDWPSDLLNIIDYTPDDTIIGTPLVDRWLWPG
ISPPASAGRVVLVGDAWHPMTPNLGQGACCALEDAVILARKLAGAIESGPASVEDALSSY
GSERWPRIFPLTVRANLVGSLLQWEDPVVCFFRNNVIFPKLVRLGPLLEHTNFDCEPLQT
SVV
Download sequence
Identical sequences MDP0000200780 MDP0000200780|PACid:22660656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]