SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000202123 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000202123
Domain Number 1 Region: 79-450
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.41e-43
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00017
Further Details:      
 
Domain Number 2 Region: 420-537
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 1.08e-34
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0000429
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000202123
Sequence length 638
Sequence
MATSLSTPKLTTTMSSSPALHNLFSKKLPSPLSLPKTLSSLSHLRRTSTSHPHHHLHSRR
RFSVSAVDSGNGADSARHYDFDLFTIGAGSGGVRASRFAANFGASVAVCELPFSTISSDT
AGGVGGTCVLRGCVPKKLLVYASKFAHEFEESNGFGWRYEIEPKHDWSTLIANKNAELKR
LTGIYKNVLSNANVTLIEGRGKIVDPHTVDVDGKLYSARHILVSVGGRPFIPEIPGSEYA
IDSDAALDLPTKPEKIAIVGGGYIAVEFAGIFNGLTSDVHVFIRQKKVLRGFDEEVRDFV
QEQMALRGIEFHAEESPQAIVKAADGSLSLKTNKGTIEGFSHIMFATGRRPNTKNLGLEA
VGVKLSKNGAMEVDKFSRTAVPSIWAVGDVTDRVNLTPIALMEGGAIAKTLFLNEPTMPD
YRAVPSAVFSQPPIGQVGLSEEQAVEQYGDVDIYTSNFRPLKATLSGLPDRTFMKLMVCA
KTNKVLGLHMCGEDSPEIVQGFAVAVKAGLTKADLDSTIGIHPTAAEEFVTMRTPTRKIR
KDPPSQGKIDSDVKAAKEYYGFSSKVLSCRFYMTRLIDLVIRLWLLKFVHDNPCGRVAGI
GVFGMTAAEFPESTDAACFLLRPVTNLSTSTSSGIFLL
Download sequence
Identical sequences MDP0000202123|PACid:22678734 MDP0000202123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]