SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000204389 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000204389
Domain Number 1 Region: 41-135
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000314
Family B3 DNA binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000204389
Sequence length 196
Sequence
MMLGEPQLQGIQGLLYGNYAPPDLPPVPSLRPLIQVHSKPFEKQLTSSDVRDDQSRLSMS
KEDVENHIFPLLKDGEDPNQGVHVTIYDMDGKEYPMVFKTWMSKINVLTGGWNSFRQDRG
LVEKIDFVTVWVFRNVLNGSLCFAINSRRFPAVSEAIKRRKRQYXDSGPPLQAHVEFNHI
NVLIGRADKSKDVFIK
Download sequence
Identical sequences MDP0000204389 MDP0000204389|PACid:22666456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]