SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000204596 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000204596
Domain Number 1 Region: 3-149,229-257
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.62e-28
Family FAD-linked reductases, N-terminal domain 0.0003
Further Details:      
 
Domain Number 2 Region: 130-231
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.37e-19
Family L-aminoacid/polyamine oxidase 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000204596
Sequence length 644
Sequence
MDWHFANLDYGCAAPLKEVSLPNWNQDDVYGGFGGAHCIIKGGYSTVVESLGEGLQIHLN
HVVTDISYGTKDAGLNTNRYNKVKVSTSNGSDFSGDAILITVPLGCLKAETIKFSPPLPH
WKHSSILRLGFGVLNKVVLEFPGVFWDDSVDYFGATAEETELRGQRFMFWNVKKTVGAPV
FIALVVGKAAIDGQNMSSSEHVTHGIVVLRKLFGEASVPDPVAAVVTDWATCKEHPDTVG
DAMMSGLREAVRIIDILTTGNDYTAEADAIAGIQRQSDSERAEVRHITRRLDAVELSYVL
YTNKEALLQDMFFNAKTTKGRLHLAKELLSLPVETLKSFARTKEGLTTLNSWILVPCYPS
ANSQSEITTCNFQSSISQAGDYRQISPNPPXMSTTTTATAGSTNAPSGHSDLQEHREEGV
PARIISGIQFLYETMPHQFETMSFAATTKLLFKVLCYGXYIIXVGGGGPKVRGTFTFGKK
DTSTDLYSICSVKQNKIRSHAIGNQEVASGIDDGLRFEHGGQVSVRAERPRIGIGGLHGV
GRGRQNSGAGGDHRGGVAAAEGDISCDILLQICENSAPKIYWHVTFDFVKTQIKGDELST
AIALRDLDTCQVVIHQVNLLDRREEKELEXLKSELSLSLRCQLS
Download sequence
Identical sequences MDP0000204596|PACid:22635084 MDP0000204596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]