SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000204628 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000204628
Domain Number 1 Region: 130-160
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000678
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000204628
Sequence length 221
Sequence
MDLEGTDGREKGEKAISTPLWAKERHHTSHHATVVLGIRSYSSIEEVRGIRQYFFSLLGK
HSTEEGGVTPSVYSRKEPRDSVRACRQRESGRDRDRDLVGTHNVVDIPQCKAHPPSINAA
VELLKQDIATCINSPGSYSCQCPKGYKHEGMDEKSCIKDNKGSKAILLIISLDQRRKFNL
SRIKVWTTRQHAGFGLRYGSLELAILNFWFPNKKYALFDPE
Download sequence
Identical sequences MDP0000204628|PACid:22666812 MDP0000204628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]