SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000208233 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000208233
Domain Number 1 Region: 8-182,248-350
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.65e-27
Family FAD/NAD-linked reductases, N-terminal and central domains 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000208233
Sequence length 356
Sequence
MQEHNKLVIIVGAGPSGLATAGCLSRLAIPYIVLEREDCFASLWKKYSYDRLHLHLQKQF
CELPHMSFPTSYPTYVPKNQFXQYLEDYVSHFSISPMYKRNVESAEYDQVSKKWIVKAKN
IGGSSEMEEYFGGFFGGGYRGSNRPEFENKKVLVVGAGNSGMEISLDLANHSAKTSIIVR
SPVHFLSRGMVYLALVLLKHFPLSMIDSLLVLLSKLVYGNLASYGIERPQEGPFYMKGKY
GKYPAIDVGAYRKIKSGEIQVLPAEIGSIRGGQVELKNGKSYPFDAIIFCTGFKRSTNLW
LKGDDYLLKEDGIPRPSIPNHWKGKNGLYCVGLSRRGLYGSKEDAQNIANDIKSFL
Download sequence
Identical sequences MDP0000208233|PACid:22624841 MDP0000208233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]