SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000208234 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000208234
Domain Number 1 Region: 8-213
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.83e-42
Family FAD/NAD-linked reductases, N-terminal and central domains 0.035
Further Details:      
 
Domain Number 2 Region: 174-222,275-356
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000038
Family FAD/NAD-linked reductases, N-terminal and central domains 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000208234
Sequence length 381
Sequence
MQEHNKVVIIVGAGPSGLATAGCLSRLAIPYIILEREDCFASLWKKYSYDRLHLHLQKQF
CELPHMSFPTSCPTYVPKHQFIQYLEDYVSHFSISPMYKRNVESAEYDQVSKKWTVKAKN
IGGSGEMEEYFGGFLVVATGEATNPYTPEIEGLSSFNGDVLHSTKYKSGKEFENKKVLVV
GAGNSGMEISLDLANHGAKTSIIVRSPVHFLSRGMVYLALVLLKHFPLSMVDSLLVLLSK
LVYGNLASYGIERPQEGPFYMKVKYGKYPAIDVGAYRKIKSGEIQVLPAEIGSIRGGQVE
LKNGKSYQFDAIILCTGFKRLTNLWLKGDDYLLKEDGIPKPSFPNHWKGKNGLYCVGLSR
RGLYGSKEDAQNIGNDIKSFL
Download sequence
Identical sequences XP_008368917.1.92800 MDP0000208234|PACid:22624840 MDP0000208234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]