SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000210966 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000210966
Domain Number 1 Region: 44-239
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.1e-26
Family FAD-linked reductases, N-terminal domain 0.00000749
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000210966
Sequence length 243
Sequence
MGFVWWRLFVAAVVVILFFHGFSSAERAPNFTFMHXATTAPDISYYDYIIVGGGTAGCPL
AASLSQNYSVLLLERGGSPYGNPNITNLSTFGSALSDLSPASPSQRFISEDGVINARARV
LGGGSCLNAGFYTRAPPDYIREAXWDGRLVNESYQWVEHLVAFRPPIQAWQSAVRNGLME
AGVMPYNGFTYDHIYGTKVGGTIFDLEGHRHTAADLLEYANPTGLTVLLHAAVHKILFRT
KGL
Download sequence
Identical sequences MDP0000210966|PACid:22644665 XP_008381922.1.92800 MDP0000210966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]