SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000211439 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  MDP0000211439
Domain Number - Region: 10-56
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000285
Family FAD-linked reductases, N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000211439
Sequence length 70
Sequence
MEGNLRFCFAGSGISGLCIAQVLASKHGDAIPNXIVTXARDRVGGNIITIEKDNYPGAEI
AAASGEEXPD
Download sequence
Identical sequences MDP0000211439 MDP0000211439|PACid:22629478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]