SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000212327 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000212327
Domain Number 1 Region: 55-233
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000812
Family FAD/NAD-linked reductases, N-terminal and central domains 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000212327
Sequence length 386
Sequence
MVYLNIVCAVIASLLGFXFLCSLRRQKKARAHQNGNCLKSCENGTCDEAKMVESADIIVV
GAGQDGRRVHVVERDLSEPDRIVGELLQPGGYLRLVELGLEDKQRNCVNEIDAQRVFGYA
LYKDGKSTKLPYPLENFHPDVAGRSFHHGXFIQRMREKASSLPKVSFVCHFLNFDINVRL
EQGMVTSLLEEKGTVKGVQYKFKGSDLELNAHAPLTIVGDGCYSNLRHSLCNPKLRMFRK
MFQXFEEGFVLDAVKNVVDDCVQLLGEGRVEIESLLVSHDGKYVVKPFYLSRFRVEPLQS
VLFTFTTVQPGIRSGVFLGASLVMSWLSSRHLFGSSEDFGSLKLXVVVPSGALLQQPRDQ
GCVEPLSRLEQCYWQFDHYEAGLYSD
Download sequence
Identical sequences MDP0000212327 MDP0000212327|PACid:22630830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]