SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000215605 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000215605
Domain Number 1 Region: 171-280
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.09e-25
Family Protein kinases, catalytic subunit 0.0032
Further Details:      
 
Weak hits

Sequence:  MDP0000215605
Domain Number - Region: 58-131
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00114
Family Hairpin loop containing domain 0.055
Further Details:      
 
Domain Number - Region: 9-35
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0402
Family EGF-type module 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000215605
Sequence length 302
Sequence
QVEQCDFYGKCGPNSICDAYTADKFECNCLPGFEPKLQRDGSGGCVRQNISSFCQNGEGF
VKLEGVKVPNTSTTRVNMNMSLKACKEECLRNCSCMAYANADERQGGSGCITWHGDLMDT
RTYSDTGQDLYVRVDAIVLAQYAKKSNSSFGKKRKIGVLVACGLFFFLLFFLACWLVKRK
RSAKATNNFASNNELGTGNFDSVYKGVLDNGKEIAVKRLAKNSSQGIGEFKNEVVLLSKL
QHRNLVRIIGCCVQDEEKMLIYEYLPNKSLDFFIFCMSFFYFCSSFYTSNIVEGKSSAGP
QV
Download sequence
Identical sequences MDP0000215605|PACid:22651517 MDP0000215605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]