SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000216129 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000216129
Domain Number 1 Region: 48-114
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.0000000000000124
Family L-aminoacid/polyamine oxidase 0.0015
Further Details:      
 
Domain Number 2 Region: 2-77,124-168
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000000414
Family FAD-linked reductases, N-terminal domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000216129
Sequence length 260
Sequence
MGGDHCFLPGGNGRLVHALAENVPILYERIVNTVRYGSGRVQLCNCCWRSLLIALVAGEA
AHKFETMPPTDAVTRVIQILKGIYEPQGITVPEPIQTICTRWGSDPFSLGAYSNVAVGAS
GDDYDILAESVGDGRLFFAGEATNRRYPATMHDAFXSGLREAANMAHYANAGALRIKINR
NPSKNAHSCASLLADLFREPDLEFGSFYVIALIKAERGNRKPASTSLTLKSGTSKLKADN
LKQKLVRRAKIMRNGNGKLG
Download sequence
Identical sequences MDP0000216129|PACid:22668259 MDP0000216129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]