SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000216164 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000216164
Domain Number 1 Region: 217-255
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000183
Family EGF-type module 0.004
Further Details:      
 
Weak hits

Sequence:  MDP0000216164
Domain Number - Region: 184-212
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000141
Family EGF-type module 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000216164
Sequence length 287
Sequence
MTGNLEITNISLYDGELQILQYVASDCYDAQGXTXEWYSPWFTVXPPYTISHTKNTFVAL
GCDTYSFFIGYRGEEKYTTGCTSICNNLGNAIDQXDTCSGVGCCQTKIPSGLQNQTXELY
SYYNHSDVWEFNPCSYAFLVQEGEFNFNSTSFRELNYTTQVPAIIDWEIGNESCDIAAKN
XGTFGCKANSSCHNRSSGYICRCLPGYEGNPYLPDGCQDIDECKAPNPCSMGTCINTPGN
YTCKCPKGYKNDDPDKIRCIKANXACFCIYNGYWVKGKVELGSCVRT
Download sequence
Identical sequences MDP0000216164|PACid:22668299 MDP0000216164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]