SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000220943 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000220943
Domain Number 1 Region: 14-118,148-239
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.01e-30
Family FAD-linked reductases, N-terminal domain 0.073
Further Details:      
 
Domain Number 2 Region: 17-51,317-414
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000194
Family FAD-linked reductases, N-terminal domain 0.059
Further Details:      
 
Domain Number 3 Region: 370-529
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000112
Family FAD/NAD-linked reductases, N-terminal and central domains 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000220943
Sequence length 533
Sequence
MAAANTHHLHSVSKIGIIGAGISGIAAAKQLSGHSPVVFEATDSIGGVWKHCSYNSTKLQ
TPRCDFEFSDYPWVERDNSSFPSHVEVLEYLHGYATHFDLLKYVKFESKVVEIRYVGGID
DHQTTTQFPMNSISGEYGNLLNGHPVWEVAVQMSNNPNMIQWYAFEFIVVCIGKYGDIPR
MPSFPRNKGQEVFQGKVLHSLDYSKLDQRAARELLKGKKVAVIGYKKSAIDVAVECAEAN
QGDSYGQPSGNCQCEMTRWAGMYNGDKDSTLDSSILLDLGASIFPLFFDKVFSIPPRKAK
PELIPSLVLPSFIAYGKFHRMVISKFIESYLEWKLPLVKYGLKPDHPFLEDYASCQMAIL
PENFFAEADKGKILFKRSSKWWFWSGGIEFEDNTKLQADVVILATGYEGKQKLQSILPEP
FRSLMVDSTGTMPLYRESVSNLHTAELXCKWLGRLVDNKFKLPTVQKMLEQIGRETEVMK
KTTRFYKRHCISTFSINHSDDICEEMGWKSWRKSNWLSEAFSPYNSRDYEEED
Download sequence
Identical sequences MDP0000220943 MDP0000220943|PACid:22675739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]