SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000227222 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000227222
Domain Number 1 Region: 68-106
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000905
Family Protein kinases, catalytic subunit 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000227222
Sequence length 106
Sequence
MRQIEMKISTGFLVLLLCASFVNGECRIDSSKCKKNIVVPILGPLLSAVALLLVIVLVLV
WKLRRIRKPGGFGNVHHGYLKDGTPVAVKTLSPSSSQGAREFQTEV
Download sequence
Identical sequences MDP0000227222|PACid:22637840 MDP0000227222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]