SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000227773 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000227773
Domain Number 1 Region: 8-245
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.57e-43
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000227773
Sequence length 278
Sequence
MASETYQPKXVCVIGAGPSGLVAARELRKEGHRVVVLEQNHEVGGQWLYDPNVEGEDPLG
RSPTLKVHSSLYSSLRIISPRESMGFTDFPFAVKKGRDMRRFPGHTELLLYLKDFCDWFG
LRELIRFNTRVSYVGMLDGDHVVGCKDLKWVVRSMEKKAEIFVEEVFDAVVVASGHYSNP
RLPSIKGMDAWKRKQMHSHIYRVPEPFRDEARQYIVVVVVANSLSGQDISIDLVAVAKAI
YLSARSLDISKGLSKVISKHENLHLRPQHHALNASSFI
Download sequence
Identical sequences MDP0000227773 MDP0000227773|PACid:22639029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]