SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000231627 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000231627
Domain Number 1 Region: 172-208
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000186
Family EGF-type module 0.006
Further Details:      
 
Weak hits

Sequence:  MDP0000231627
Domain Number - Region: 138-180
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0768
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000231627
Sequence length 234
Sequence
MGSFTLPNTQPYNVTINQIVGYKNETYGYTDGCTTRCGSIEFVANGSCTGIGCCQTSIPQ
GMTYFFVTAESFGNHMDVYSFNPCSFSSVVQEGKFSFFSNMLSSDYLKNASLPVVLDWSV
GNETCSNVVEKKQVMNYTCQGNTMCYDVENGSGYRCKGKDGYQGNPYLNDCYDIDECMVP
KLNTCKQKCINTEGNYTCSCHKGYHGDGRKDGEGCTPDRNFVIQIVVGKQLNES
Download sequence
Identical sequences MDP0000231627 MDP0000231627|PACid:22628501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]