SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000231799 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000231799
Domain Number 1 Region: 77-427
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.01e-50
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0013
Further Details:      
 
Domain Number 2 Region: 436-550
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 1.2e-34
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000231799
Sequence length 614
Sequence
MQASLSLPALSHAVPRSNYVVQSALPLPPSKPINLRFCGLHREALGFSHLAXSDSHRVRL
SAPSRSATISASSSSGNAXPPKSFDYDLLIIGAGVGGHGAALHAVEKGLKTAIVEGDVVG
GTCVNRGCVPSKALLAVSGRMRELQNEHHLKALGLQVSAAGYDRQGVADHANNLATKIRN
SLTNSMNSLGVDILTGVGTILGPQKVQIGSSDKVXTAKDIIIATGSVPFVPKGVEVDGKT
VITSDHALKLEFVPEWIAIVGSGYIGLEFSDVYTALGSEVTFIEALDQLMPGFDPEIGKL
AQRVLINPRKIDYQTGVFASKITPAKDGKPVTIDLIDAKTKEPKETLEVDAALIATGRAP
FTQGLGLENVDVATQRGFIPVDERMRVIDANGKLVPHLFCIGDANGKMMLAHAASAQGIS
VVEQVTGRDHVLNHLSIPAACFTHPEISMVGLTEPQAREKAEKEGFEVSIAKTSFKANTK
ALAENEGEGLAKLIYRPDNGEILGVHIFGLHAADLIHEASNAIALGTRIQXIKFAVHAHP
TLSEVLDELFKSAKVAHVSSPGVSASFISQERRDQHPEKRRNLRESXTTWPEIFFAFVAW
ILSSVHGLKKHLYS
Download sequence
Identical sequences MDP0000231799 MDP0000231799|PACid:22673471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]