SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000232295 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000232295
Domain Number 1 Region: 14-301,448-500
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.44e-52
Family FAD-linked reductases, N-terminal domain 0.00000347
Further Details:      
 
Domain Number 2 Region: 345-449
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.86e-18
Family GMC oxidoreductases 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000232295
Sequence length 506
Sequence
MSVFEIAGQTLPHITSDVNEASGKSFDYIVIGGGTAGCPLAATLSEKFSVLLVERGGSPY
GDPLVLDTKYYGFSLLRTDQYTSVAQXFVSNDGVRNLRGRVLGGGSAINGGFYSRASEDF
VEKVGWDKEMVTNAYQWVESRIVFKPELTPWQYAAEFSFLEAGVFPYNGFSXDHIEGTKI
GASVFDEQGRRHTSADLLEAGNPNHITVLLNATVTNVIFHERGDRNETXARGIRFIKSNG
NSSEIYEAHLNQPENSCSGGDVILAAGALGSPQILLLSGIGPHQHLNNFNIQLVLDLEAV
GKGMKDNPGIALLADPTPKNFPPEPPKVVGIADDFKIIIEAGILPVSSNATIMPIAAKLA
FPESEGKLELNSTDPRENPSVTFNYLAKEKDLAQCLKLAQLLERVVRSESIAFFLGIERK
PKDKLMSTEDELRKLCTKNVITFFHYHGGCTMGSVVDKDYRVYGVKGLRVVDGSTFFESP
GTNPMATLLMLGRYQGMKVLQERENA
Download sequence
Identical sequences MDP0000232295|PACid:22657598 MDP0000232295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]