SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000233110 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000233110
Domain Number 1 Region: 237-512,677-741
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.61e-49
Family FAD/NAD-linked reductases, N-terminal and central domains 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000233110
Sequence length 743
Sequence
MEGRESSCHPLLKGGRRESKFSHGFSSAQMQSLAAICEALIPPLSLEEIPDDHQALHYSS
SSYHTASGSQPPIPDEVAEMIVKRAQPEAVDAMRLFLKMLSLRLGTFLLCGKICFDWKWP
FIHKFSEXSLDKREQVLNKWSRGKLVITIRLMFMVVKMFCFYTFFSRIDENSRNPAWKAI
GFDLDKKEKLIKTPKERPLDKGIIETVYESDSTLVQSLTKKGLEVADDAANNIHRINCDV
VIVGSGCGGGVAAAVLAQSGQKVVVLEKGNYFVPKDYSSLEGPSMSELYESGGIMASVDA
MVMILAGSTVGGGSAVNWSASIRTPHNVLREWSVDHKIPLYASEDYQSAMDIVCKRISVT
EGCTEENFQNQILRKGCENLGLKVESVPRNSSADHYCGFCNYGCPTGDKKGTDSTWLVDA
VECGAVILTGCKAEKFILESDNDGGRRKRCLGVQATSXSKNIKRKLKIEAKVTISACGSL
LTPPLMISSGLKNRNIGRNLHLHPVLLSWGYFPQHESEFXXKKYEGGIITSIHKVVSETA
NARAIXETAVLGPASFATLSPWISRLDMKDKMEKYARTANLFALVRDXSSGVVKREGRVH
YTLDQLDKENLLAGLRQALRILIAAGAVEVGTYRNDGQRIKCKGVKEEDLEEFLDTVVTS
AGPSAREELWTIYSSAHQMGSCRMGATEEEGGVDENGESWEAKGLFVCDASLLPTAVGVN
PMITIESTAYCISKKIAQSLDKD
Download sequence
Identical sequences MDP0000233110 MDP0000233110|PACid:22669060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]