SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000233995 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000233995
Domain Number 1 Region: 3-205
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.94e-42
Family FAD/NAD-linked reductases, N-terminal and central domains 0.052
Further Details:      
 
Domain Number 2 Region: 170-209,246-346
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000594
Family FAD/NAD-linked reductases, N-terminal and central domains 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000233995
Sequence length 365
Sequence
MEEVQVVIVGAGPAGLATSACLNHLKIPNVVLEREDCYASLWKKKSYDRLKLHLAKEFCE
LPYMPFPSNAPTYIPKDMFVQYLDNYVSQFKINPKCNRSVKSAFFDANVEKWRVTVENIL
SGEQEIYLGKFLVVASGENSVGYIPHVQGLDGFKGEAVHSSKYENGRKYSGKNVLVVGSG
NSGMEIAYDLSNSGANTSIVVRSPVHVLNKEIVHFGMVLLKFIPLKMVDKVVVRLGKLKY
GNLSKFGIRRPKEGPFYLKATKGRSATIDVLPSITSIDGNLIKFANGNYNWYDAIIFATG
YSSSVLNWFKDDNDYFDDNGMPRKSFPNHWKSEKGLYSAGFSRRGLFGIADDAQCIANDI
SSCLN
Download sequence
Identical sequences MDP0000233995 MDP0000233995|PACid:22662680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]