SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000235080 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000235080
Domain Number 1 Region: 1-229,335-370
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.52e-25
Family FAD-linked reductases, N-terminal domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000235080
Sequence length 375
Sequence
MNTTKVAVVGSGISGAVCASTLARNGVSVTLFESARGPGGRMSQRREVVEDEKELLFDHG
APFFNANKTEVLGLVXEWESKGLVACWKEKFGFFDRISNKFFDLEQEGLISKRYVGMPGM
NSICRALCQEPGVESKFGANVGRLEWLEDENLWSLIGSDGQNLGQFKGVVATDKNLVXPR
FTSVTGRQPPLGIEHTPSNLNLVPELAVKLNXIPVRPCFALMIAFSEPVSSIPFKGFSIK
SSEVLSWAHCDSSKPGRSTSSERWVLHSTMEYAQSVIAQTGLQKLSNATLTKVAEELFQE
FQSMGLNIPHAFFKKAHRWGSAFPAASVAGDEKCLWDKNKRLAICGDFCVSPNVEGAIAS
GIAAASKLTEILSCL
Download sequence
Identical sequences MDP0000235080 MDP0000235080|PACid:22654616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]