SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000235846 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000235846
Domain Number 1 Region: 49-355
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.07e-42
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000101
Further Details:      
 
Domain Number 2 Region: 425-462,522-579
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000281
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000235846
Sequence length 635
Sequence
MGFRPNPKKMLSLMRRSRSAVGLAAAASFASSRSSSSASTSAAPKLASPTDDLKTLRTKV
CIIGSGPAAHTAAIYAARAELKPILFEGMMANDIAPGGQLTTTTDVENFPGFPDGILGFE
LMDRCRKQSIRFGTAVFTETVNKVDFSTTPFKIFANERTVLADSVVVATGAVAKRLQFPG
SEEYWNRGISACAVCDGAAPIFRNKPLAVIGGGDSAMEEANFLTKFGSEVHIIHRRDTFR
ASKIMQHRALNNPKIQVVWNSVVVEAYGEGKGPLAGLKVKNVVTGEVSDLKVSGLFFAIG
HEPASKFLDGQLELHDDGYVATKPGTTQTSVKGVFAAGDVQDKKYRQAITAAGSADFRFA
VGKDYGKISLLFGSXISYLCIXLSIFMLDDAWQPWKQNTTCKRLDPRREEEAQKLVSAMD
DRKTLRTRICVIGSGLPAHTAAVYAARAELKPILALRGLHVQQNRPGGRHHHHHPLRELP
GIPSNNSHDQLPNAVSPFRHHDLLGNGQQSRLLGDPFQDQKTARPCRLRRRHHWRRRQTP
SLHWLRGGCGTRRWVIVKNVVTGAVWDLKVSGLFLAVGHDPGHRIFERAVEARCGCGWVC
CDEAGDNGDHRERSFCGGRCLGQEVPIGYHCCWNR
Download sequence
Identical sequences MDP0000235846|PACid:22627807 MDP0000235846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]