SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000236092 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000236092
Domain Number 1 Region: 49-245
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.99e-45
Family Thi4-like 0.0000000489
Further Details:      
 
Domain Number 2 Region: 473-542
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.81e-22
Family PCI domain (PINT motif) 0.0017
Further Details:      
 
Weak hits

Sequence:  MDP0000236092
Domain Number - Region: 1036-1081
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 0.0418
Family Cellulose-binding domain family II 0.03
Further Details:      
 
Domain Number - Region: 760-810
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 0.0837
Family Cellulose-binding domain family II 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000236092
Sequence length 1204
Sequence
MASTLTSSSLTAKLQKSSLLDSSFHGAPMVRLQLAKAAPANNGGLSVSMSANGLTPSYDL
SAFKFDPIKESIVSREMTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSKNPDVQVAII
EQSVSPGGGAWLGGQLFSAMVVRKPAHLFLNELGIDYDEQDNYVVIKHAALFTSTIMSKL
LARPNVKLFNAVAAEDLIIKGGRVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGH
DGPMGATGVKRLRSVGMIESVPGMKALDMNAAEDAIVKLTREIVPGMIVTGMEVAEIDGS
PRMPLLCLADFIQPLQAIAITFSQNGDPVVAQREAVVRAPGXXXIRRRPASGASTSAAAA
PGXEESVEGSDXEDVEGEYDAKASKKREKKRQEREAQRQAEQAARESRVTKQDRYAEMRR
RKDEEREAQERQLEEEAKAQKAREEEAAALEFEKWKGEFSIDAEGXTENEVQDGXQDLLS
DFVEYIKKHKCIPLEDLAAESKLRTQECIXRITNLESMGRLSGVMDDRGKYIYISQEEMQ
AVADYIKRQGRAMLVVFLVFSCFRVEICYGQDEDAVVAAPPPEQEDCDGIFLSYTFTSRE
KELPHTKNXSAQAWAFKSEATILNAGSTELKAWKMYIGFQHREILVAAEGAQMVDGGDLP
VDVGTKGAYFAGYPMTDLKTMIDTAGDYTQIQAKIAFKGTQFGMGEKSTPMPKTISIVND
GFKCPAAKFKGKTAMSVCCKKDPKFKAKKVEKTKFMPRQNGDLSITYDVMQTYTMNYLAQ
VTIDNVHPLGRLDHWNLTWEWMRGEFINTMRGAYTHKKDTSACLYGQAGKFYKDLDFSQV
MNCEKKPVITDLPAERKDDPKVGKLPSCCRNGTILPSLMDXAQSQSIFQLQVFKIPPDDN
RTAITPPQQWKISGVLNPTYRCGPPIRVDPTQFPDPSGLQATSDAIASWQVVCNITKTPV
PRCCVSFSAYYSTSVIPCSTCACGCKTSETNKCNPKASAMLLPAEALLVPFANRTEKAKA
WAKIKHYDVPKKLPCPDNCGVSLNWHIDSDYSNGWTARLTLFNWGTDQFQDWYTAVKMNK
AYQDYENVYSFNGTRMEKEVNNTILFTGLKGLNYLVAIKNGTDPKKNPMIPGKQQSVISF
KKKHYHNIDIKAGQGFPTRVLFNGEECALPKVFPKNNAGHLKSNALLVLCXAIMSFLFMT
NRFH
Download sequence
Identical sequences MDP0000236092|PACid:22632501 MDP0000236092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]